abnumber
AbNumber - Antibody numbering using ANARCI
Decision gist · record as of 2026-08-14
Yes, if you work with antibody sequences and need standard numbering and alignment. The low install friction, permissive license, and clean API make it straightforward to adopt. However, note the aging maintenance status (452 days since last release) and Unix/macOS-only requirement. For production immunology pipelines, verify that anarcii remains stable and that the package's dependencies are current before committing to it.AI-flagged interpretation of the facts on this page — verify before relying
Before you install
- Windows is not supported; HMMER dependency requires Unix or macOS.
- Low friction install as a pure Python wheel.
- Maintenance status is aging—last release was 452 days ago—but the repository remains active and unarchived with 128 stars.
License · maintenance · safety
MIT (permissive) — MIT license is permissive, allowing commercial and private use with minimal restrictions. No licensing friction for most use cases.
last release 2025-05-19 (452 days) · last repo commit 2025-05-19 · 128 stars
0 known vulnerabilities (OSV.dev, 2026-08-14) · 78,580 downloads/mo, #14,426 on PyPI
Alternatives
Verify before relying
from abnumber import Chain
seq = 'QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSAKTTAPSVYPLA'
chain = Chain(seq, scheme='imgt')
print(chain.cdr3_seq) # ARYYDDHYCLDY- Whether anarcii (the runtime dependency) is a maintained fork or wrapper of ANARCI, and its current stability status.
- Performance characteristics when processing large antibody sequence batches or multiple alignments.
- Whether the package is actively maintained or in maintenance-only mode given the 452-day gap since last release.
What it is and what it does
AbNumber wraps ANARCI to provide a Python-friendly interface for antibody sequence analysis. It lets you load an antibody sequence into a Chain object, then identify CDR regions, access positions using standard antibody numbering schemes (IMGT, Chothia), slice and iterate over sequences by position, and align sequences to each other or to human germlines. The package handles the complexity of ANARCI's command-line interface and sequence alignment logic, exposing it through object methods like chain.cdr3_seq, chain.regions, and chain.align().
The core use case is immunology and antibody engineering workflows where you need to work with antibody sequences in their standard numbering systems rather than raw coordinates. It depends on biopython for sequence handling, pandas for data manipulation, and anarcii for the underlying numbering and alignment engine. The package requires Python 3.6 or later and runs only on Unix and macOS due to HMMER dependencies.
Use it for
- Extract and analyze CDR regions from antibody sequences for epitope prediction or humanization design.
- Align antibody sequences to nearest human germlines to assess how close a candidate is to natural repertoire.
- Graft CDRs from one antibody onto a human germline framework for humanization workflows.
- Index and slice antibody sequences by standard numbering (e.g., chain['H2':'H5']) for position-specific analysis.
- Batch-process antibody libraries to identify conserved regions or perform comparative sequence analysis.
Worth the install?
AI-flagged interpretation of the facts on this page. Verify before relying on it.
Yes, if you work with antibody sequences and need standard numbering and alignment.
The low install friction, permissive license, and clean API make it straightforward to adopt. However, note the aging maintenance status (452 days since last release) and Unix/macOS-only requirement. For production immunology pipelines, verify that anarcii remains stable and that the package's dependencies are current before committing to it.
Install
abnumber on PyPI
Before you install
Low friction install as a pure Python wheel. Maintenance status is aging—last release was 452 days ago—but the repository remains active and unarchived with 128 stars. Note: Windows is not supported due to HMMER dependency; Unix and macOS only.
Windows is not supported; HMMER dependency requires Unix or macOS.
License in practice
MIT license is permissive, allowing commercial and private use with minimal restrictions. No licensing friction for most use cases.
Quickstart
from abnumber import Chain
seq = 'QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSAKTTAPSVYPLA'
chain = Chain(seq, scheme='imgt')
print(chain.cdr3_seq) # ARYYDDHYCLDYVerify before relying
- Whether anarcii (the runtime dependency) is a maintained fork or wrapper of ANARCI, and its current stability status.
- Performance characteristics when processing large antibody sequence batches or multiple alignments.
- Whether the package is actively maintained or in maintenance-only mode given the 452-day gap since last release.
Package facts
| License | MIT permissive |
| Python support | Supports the current Python release >=3.6 |
| Install friction | Low. Pure-Python wheel |
| Runtime dependencies | 3 packagesbiopythonpandasanarcii |
| Maintenance | Aging 452 days since the last release |
| Last repo commit | |
| First released | |
| Downloads | 78,580 / month, #14,426 on PyPI 30-day window, as of 2026-08-14 |
| Known vulnerabilities | None known OSV.dev, checked 2026-08-14 |
Evidence: abnumber-0.4.4-py3-none-any.whl
Tags
Let your AI agent find packages like this
Example. Real query, live index.
You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.
wish › “antibody numbering python”
- abnumberAbNumber provides Python APIs to number and align antibody sequences…
- antibertyAntiBERTy is a transformer language model pre-trained on antibody…
- pipebioA Python SDK for the PipeBio cloud platform that enables programmatic…
Give your agent the search over MCP, or paste the wish link into any chat.
More Information Analysis packages
A drop-in replacement for Python's standard `re` module that adds advanced regex features like nested sets, fuzzy matching, lookaround in conditionals, and full Unicode case-folding while maintaining backward compatibility.
pyarrow provides Python bindings to Apache Arrow's C++ libraries for efficient columnar data processing, serialization, and interoperability with pandas, NumPy, and other Python ecosystem tools.
NetworkX provides data structures and algorithms for creating, analyzing, and manipulating graphs and networks, supporting everything from simple undirected graphs to complex directed and weighted networks.
Connects Python applications to Snowflake data warehouses using the DB API 2.0 specification, enabling SQL queries, data transfers, and warehouse operations.
ContourPy calculates contours of 2D quadrilateral grids using C++11 algorithms wrapped in Python, offering serial and multithreaded implementations without requiring Matplotlib as a dependency.
Snowpark Python provides APIs to query and process data directly in Snowflake without moving data to your local system, with support for both native Snowpark and pandas-compatible interfaces.
Install it if you use Snowflake and want to process data without moving it to your application layer.
See also antiberty · pipebio · pyhmmer · bx-python · biotite · logomaker · pydeseq2 · mhctools · biocommons.seqrepo · epiweeks