antiberty
Decision gist · record as of 2026-08-14
Yes, if you work with antibody sequences and need a pre-trained transformer encoder—the model is specialized and the install is frictionless. No, if you need active maintenance or support; the package is abandoned and has no license metadata. Consider it a research artifact: useful for one-off analysis or as a feature extractor in a larger pipeline, but not for production systems requiring updates or legal clarity.AI-flagged interpretation of the facts on this page — verify before relying
Before you install
- Requires torch and transformers; model weights are downloaded on first use.
- Installation is straightforward with low friction via pip.
- However, the package is marked as abandoned with no updates since July 2023, so expect no maintenance or bug fixes going forward.
License · maintenance · safety
(unclear) — License status is unclear—no SPDX identifier or raw license text is provided in the package metadata, making it difficult to assess legal obligations before use.
last release 2023-07-16 (1125 days)
0 known vulnerabilities (OSV.dev, 2026-08-14) · 120,393 downloads/mo, #12,025 on PyPI
Alternatives
Verify before relying
pip install antiberty
from antiberty import AntiBERTyRunner
antiberty = AntiBERTyRunner()
sequences = ["EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS"]
embeddings = antiberty.embed(sequences)- Minimum Python version and specific torch/transformers version requirements not documented in metadata.
- Whether pre-trained model weights are bundled or downloaded at runtime, and total download/storage footprint.
- Current status of the GitHub repository (archived flag is null in metadata).
What it is and what it does
AntiBERTy is a BERT-style transformer model trained on natural antibody sequences. It provides a pre-trained encoder for antibody protein analysis, allowing you to extract learned representations of antibody sequences without training from scratch. The package wraps the model in a simple Python interface with methods to generate fixed-dimension embeddings, classify antibody species and chain type, fill in masked positions, and score sequence likelihood.
You instantiate an AntiBERTyRunner, then call methods like embed(), classify(), fill_masks(), or pseudo_log_likelihood() on lists of antibody sequences. It depends on torch and transformers for the underlying model and inference. The model is designed for computational biology workflows where you need to work with antibody sequences programmatically—for example, screening variants, analyzing affinity maturation, or featurizing sequences for downstream machine learning.
Use it for
- Generate fixed-size vector representations of antibody sequences for clustering, similarity search, or downstream ML models.
- Classify antibody sequences by species origin and chain type automatically.
- Predict missing or masked residues in antibody sequences based on learned patterns.
- Score the likelihood of antibody sequences to identify natural vs. synthetic variants.
- Analyze attention patterns across antibody sequences to understand model reasoning.
Worth the install?
AI-flagged interpretation of the facts on this page. Verify before relying on it.
Yes, if you work with antibody sequences and need a pre-trained transformer encoder—the model is specialized and the install is frictionless.
No, if you need active maintenance or support; the package is abandoned and has no license metadata. Consider it a research artifact: useful for one-off analysis or as a feature extractor in a larger pipeline, but not for production systems requiring updates or legal clarity.
Install
antiberty on PyPI
Before you install
Installation is straightforward with low friction via pip. However, the package is marked as abandoned with no updates since July 2023, so expect no maintenance or bug fixes going forward.
Requires torch and transformers; model weights are downloaded on first use.
License in practice
License status is unclear—no SPDX identifier or raw license text is provided in the package metadata, making it difficult to assess legal obligations before use.
Quickstart
pip install antiberty
from antiberty import AntiBERTyRunner
antiberty = AntiBERTyRunner()
sequences = ["EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS"]
embeddings = antiberty.embed(sequences)Verify before relying
- Minimum Python version and specific torch/transformers version requirements not documented in metadata.
- Whether pre-trained model weights are bundled or downloaded at runtime, and total download/storage footprint.
- Current status of the GitHub repository (archived flag is null in metadata).
Package facts
| License | Not declared unclear |
| Python support | Not specified |
| Install friction | Low. Pure-Python wheel |
| Runtime dependencies | 2 packagestorchtransformers |
| Maintenance | Abandoned 1,125 days since the last release |
| First released | |
| Downloads | 120,393 / month, #12,025 on PyPI 30-day window, as of 2026-08-14 |
| Known vulnerabilities | None known OSV.dev, checked 2026-08-14 |
Evidence: antiberty-0.1.3-py3-none-any.whl
Tags
Let your AI agent find packages like this
Example. Real query, live index.
You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.
wish › “antibody sequence embedding”
- antibertyAntiBERTy is a transformer language model pre-trained on antibody…
- abnumberAbNumber provides Python APIs to number and align antibody sequences…
- pipebioA Python SDK for the PipeBio cloud platform that enables programmatic…
Give your agent the search over MCP, or paste the wish link into any chat.
More Artificial Intelligence packages
LiteLLM provides a unified Python interface to call 100+ LLM providers (OpenAI, Anthropic, Gemini, Bedrock, Azure, and others) using OpenAI-compatible API format, available as both a Python SDK and a self-hosted AI Gateway proxy server.
Install it if you need to work with multiple LLM providers or want to centralize LLM routing in your organization.
Client library and CLI tool for downloading, uploading, and managing models, datasets, and repositories on the Hugging Face Hub platform.
Install it if you work with Hugging Face Hub models or datasets.
LangChain provides a framework for building agents and LLM-powered applications by composing language models, tools, and memory through a unified API that abstracts over multiple model providers.
hf-xet provides chunk-based deduplication and efficient file transfer for the Hugging Face Hub, enabling faster uploads and downloads of large files with local disk caching.
Tokenizers converts raw text into token sequences for NLP models, with support for training custom vocabularies and using pre-built tokenizers (BPE, WordPiece) optimized for speed via Rust.
Transformers provides a unified framework for loading, fine-tuning, and running state-of-the-art pretrained models across text, vision, audio, video, and multimodal tasks using PyTorch, JAX, or TensorFlow.
Install it if you need to run or train any transformer-based model for NLP, vision, audio, or multimodal tasks.
See also abnumber · fair-esm · pipebio · model2vec · axial-positional-embedding · sentence-transformers · vit-pytorch · detoxify · llama-index-embeddings-huggingface · pytorch-pretrained-bert