$npx skillfedfor your agent

win-precise-time

With conditionsPyPI UtilitiesReleased Oct 2023184.6K downloads / moMITPlatform wheel

Decision gist · record as of 2026-08-14

platform wheels — win_precise_time-1.4.2-cp310-cp310-win32.whl · win_precise_time-1.4.2-cp310-cp310-win_amd64.whl · win_precise_time-1.4.2-cp311-cp311-win32.whl
v1.4.2 · released 2023-10-08 · Python >=3.7

Yes, if you are on Windows and need microsecond-resolution timing or sub-millisecond sleep precision. The package is stable, permissively licensed, and has no known vulnerabilities. However, expect no active maintenance or updates; dormant status means community support is limited. Not applicable on non-Windows platforms.AI-flagged interpretation of the facts on this page — verify before relying

Before you install

  • Windows-only; requires Python 3.7 or later and a Windows OS (wheels provided for win32 and win_amd64 only).
  • Medium friction: platform-specific compiled wheels for Windows only (cp37–cp312, win32 and win_amd64).
  • Dormant maintenance (last release 2023-10-08, last commit 2024-10-09); no active development but repository not archived.

License · maintenance · safety

MIT (permissive) — MIT license (permissive); no restrictions on commercial or private use, modification, or distribution provided the license text is retained.

last release 2023-10-08 (1041 days) · last repo commit 2024-10-09 · 7 stars

0 known vulnerabilities (OSV.dev, 2026-08-14) · 184,628 downloads/mo, #10,029 on PyPI

Verify before relying

pip install win-precise-time

import win_precise_time as wpt
wpt.time()  # retrieve current time with high precision
wpt.sleep(0.001)  # sleep for 1ms with sub-millisecond precision
  • Whether the package works reliably on all supported Python versions given dormant maintenance status.
  • Real-world precision guarantees under different system loads or timer configurations.
  • Compatibility with Windows Server editions or non-standard Windows configurations.
Same gist for agents: .md · .json

What it is and what it does

win-precise-time is a Windows-only C extension that provides microsecond-resolution time measurement and sub-millisecond sleep precision, addressing a Windows-specific limitation where the builtin time.time() offers only ~15ms resolution. The package exposes two main functions: time() retrieves the current timestamp using GetSystemTimePreciseAsFileTime, and sleep() implements a more precise sleep by using SetWaitableTimerEx without requiring system-wide timer resolution changes. Both functions are implemented in C and perform comparably to the builtin time.perf_counter(). The package has no runtime dependencies and supports Python 3.7 through current versions on both 32-bit and 64-bit Windows.

The package is useful for Windows developers who need accurate timing for benchmarking, performance profiling, or real-time applications where millisecond-level jitter is unacceptable. It is production-stable but dormant; the last release was 2023-10-08 and the repository shows no active development, though it remains unarchived and free of known security vulnerabilities.

Use it for

  • Benchmarking and profiling Windows applications where builtin time.time() resolution is insufficient.
  • Real-time or latency-sensitive applications requiring sub-millisecond sleep precision without global timer changes.
  • Performance testing frameworks that need accurate microsecond-level timing on Windows.
  • Game engines or multimedia applications on Windows requiring precise frame timing.
  • Replacing time.time() and time.sleep() in code when running on Windows to avoid precision loss.

Worth the install?

AI-flagged interpretation of the facts on this page. Verify before relying on it.

With conditions

Yes, if you are on Windows and need microsecond-resolution timing or sub-millisecond sleep precision.

The package is stable, permissively licensed, and has no known vulnerabilities. However, expect no active maintenance or updates; dormant status means community support is limited. Not applicable on non-Windows platforms.

Install

win-precise-time on PyPI

Before you install

Medium friction: platform-specific compiled wheels for Windows only (cp37–cp312, win32 and win_amd64). Dormant maintenance (last release 2023-10-08, last commit 2024-10-09); no active development but repository not archived.

Windows-only; requires Python 3.7 or later and a Windows OS (wheels provided for win32 and win_amd64 only).

License in practice

MIT license (permissive); no restrictions on commercial or private use, modification, or distribution provided the license text is retained.

Quickstart

pip install win-precise-time

import win_precise_time as wpt
wpt.time()  # retrieve current time with high precision
wpt.sleep(0.001)  # sleep for 1ms with sub-millisecond precision

Verify before relying

  • Whether the package works reliably on all supported Python versions given dormant maintenance status.
  • Real-world precision guarantees under different system loads or timer configurations.
  • Compatibility with Windows Server editions or non-standard Windows configurations.

Package facts

LicenseMIT permissive
Python supportSupports the current Python release >=3.7
Install frictionMedium. Platform-specific wheel
Runtime dependenciesNone
MaintenanceDormant 1,041 days since the last release
Last repo commit
First released
Downloads184,628 / month, #10,029 on PyPI 30-day window, as of 2026-08-14
Known vulnerabilitiesNone known OSV.dev, checked 2026-08-14
Classifiers
Development Status :: 5 - Production/StableProgramming Language :: PythonProgramming Language :: Python :: 3Programming Language :: Python :: Implementation :: CPython

Evidence: win_precise_time-1.4.2-cp310-cp310-win32.whl; win_precise_time-1.4.2-cp310-cp310-win_amd64.whl; win_precise_time-1.4.2-cp311-cp311-win32.whl; win_precise_time-1.4.2-cp311-cp311-win_amd64.whl; win_precise_time-1.4.2-cp312-cp312-win32.whl; win_precise_time-1.4.2-cp312-cp312-win_amd64.whl; win_precise_time-1.4.2-cp37-cp37m-win32.whl; win_precise_time-1.4.2-cp37-cp37m-win_amd64.whl; win_precise_time-1.4.2-cp38-cp38-win32.whl; win_precise_time-1.4.2-cp38-cp38-win_amd64.whl; win_precise_time-1.4.2-cp39-cp39-win32.whl; win_precise_time-1.4.2-cp39-cp39-win_amd64.whl

Tags

Capabilities
windows high resolution timerprecise sleep windowssub-millisecond sleepwindows time accuracygetsystemtimepreciseasfiletimequeryperformancecounter wrapperwindows timer precision
Topics
windows-onlytiming-precisionc-extension
PyPI keywords
WindowstimesleepGetSystemTimePreciseAsFileTimeSetWaitableTimerExCREATE_WAITABLE_TIMER_HIGH_RESOLUTION

Let your AI agent find packages like this

Example. Real query, live index.

You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.

wish › “windows high resolution timer”

  • win-precise-timeProvides high-resolution time measurement and sub-millisecond sleep…
  • monotonicProvides a monotonic clock function that returns elapsed time in…
  • python-timeoutGenerates random timeouts between specified minimum and maximum…

Give your agent the search over MCP, or paste the wish link into any chat.

More Utilities packages

idna Worth it
PyPI · Python Modules · released Jun 2026

Converts domain names between Unicode and ASCII-compatible encoding (Punycode) according to IDNA 2008 and Unicode Technical Standard 46, with security validation and broader script coverage than the standard library.

Install it if you work with internationalized domain names, need to validate domains, or use HTTP clients that depend on it transitively.

BSD-3-Clausepure Python · 3.9+
1.8Bdownloads / mo
charset-normalizer Worth it
PyPI · Utilities · released Aug 2026

Detects and normalizes text encoding from unknown or ambiguous sources, supporting all IANA character sets that Python's core library provides codecs for, with the ability to register custom codecs.

permissive licensepure Python · 3.7+
1.7Bdownloads / mo
setuptools Worth it
PyPI · Python Modules · released Aug 2026

Setuptools is a Python build backend and package management tool that handles building, distributing, and installing Python packages, including support for C/C++ extension modules.

MITpure Python · 3.10+
1.6Bdownloads / mo
pluggy Worth it
PyPI · Libraries · released May 2025

Pluggy provides a plugin system that lets you define hook specifications and register implementations to be called in sequence, enabling extensible Python applications without tight coupling.

Install it if you're building an extensible application or framework.

MITpure Python · 3.9+aging
1.3Bdownloads / mo
Pygments Worth it
PyPI · Utilities · released Mar 2026

Pygments is a syntax highlighter that colorizes source code and text in over 500 languages and formats, outputting to HTML, LaTeX, RTF, SVG, images, or ANSI terminal sequences.

Install it if you need to display or transform source code.

BSD-2-Clausepure Python · 3.9+
1.3Bdownloads / mo
six With conditions
PyPI · Libraries · released Dec 2024

Six provides utility functions to write Python code that runs on both Python 2.7 and Python 3.3+, smoothing over language differences between the two versions.

MITpure Python
1.2Bdownloads / mo

See also stopwatch.py · python-timeout · win32-setctime · uiautomation · ntstatus · nanotime · recognizers-text-date-time · codetiming · monotonic · about-time