wikipedia-mcp
MCP server for Wikipedia API
Decision gist · record as of 2026-08-14
Yes, if you are building an LLM application (especially Claude Desktop) that needs reliable factual grounding. The package is actively maintained, has no known vulnerabilities, installs cleanly, and offers rich Wikipedia integration with multi-language support and flexible transport options. Install via pipx for Claude Desktop or pip for programmatic use.AI-flagged interpretation of the facts on this page — verify before relying
Before you install
- Requires Python >=3.10.
- For Claude Desktop use, wikipedia-mcp command must be in PATH or full path specified in config.
- Low friction: pure Python wheel with four runtime dependencies (fastmcp, wikipedia-api, requests, python-dotenv).
License · maintenance · safety
MIT (permissive) — MIT license permits commercial and private use with minimal restrictions—suitable for most deployment scenarios.
last release 2026-05-01 (105 days) · last repo commit 2026-05-01 · 285 stars
0 known vulnerabilities (OSV.dev, 2026-08-14) · 118,638 downloads/mo, #12,108 on PyPI
Alternatives
Verify before relying
pip install wikipedia-mcp
wikipedia-mcp --transport stdio
# In Claude Desktop config:
# {"mcpServers": {"wikipedia": {"command": "wikipedia-mcp"}}}- Whether caching (--enable-cache) persists across server restarts and what storage backend it uses.
- Rate-limiting behavior when accessing Wikipedia without a personal access token.
- Performance characteristics for large article retrievals or high-volume queries.
What it is and what it does
Wikipedia-mcp is a Model Context Protocol server that bridges Wikipedia and large language models, allowing AI assistants to retrieve factual information directly from Wikipedia during conversation. It wraps the Wikipedia API behind the MCP interface, exposing tools for article search, full-text retrieval, summaries, section extraction, link discovery, and related-topic suggestions. The server supports multiple languages and regional variants (e.g., Simplified vs. Traditional Chinese, Serbian scripts) via country codes or explicit language tags, and can run over stdio (for Claude Desktop), HTTP, or streamable-HTTP transports with optional static or JWT authentication.
The package is designed for developers integrating LLMs with reliable reference sources. It handles Wikipedia's API directly through wikipedia-api and fastmcp, manages HTTP requests via requests, and supports environment configuration through python-dotenv. Installation is straightforward via pipx (recommended for Claude Desktop) or pip, and the server runs as a command-line tool with extensive configuration options for transport, language, caching, and security.
Use it for
- Integrate Claude Desktop with Wikipedia so it can cite and verify factual claims during conversations.
- Ground LLM responses in real-time Wikipedia content for research, tutoring, or fact-checking applications.
- Deploy a multi-language Wikipedia MCP server in Kubernetes or Docker for AI frameworks requiring strict function schemas.
- Cache Wikipedia queries to reduce API calls and improve response latency in high-volume LLM deployments.
- Secure network MCP transports with static bearer tokens or JWT validation for production AI agent infrastructure.
Worth the install?
AI-flagged interpretation of the facts on this page. Verify before relying on it.
Yes, if you are building an LLM application (especially Claude Desktop) that needs reliable factual grounding.
The package is actively maintained, has no known vulnerabilities, installs cleanly, and offers rich Wikipedia integration with multi-language support and flexible transport options. Install via pipx for Claude Desktop or pip for programmatic use.
Install
wikipedia-mcp on PyPI
Before you install
Low friction: pure Python wheel with four runtime dependencies (fastmcp, wikipedia-api, requests, python-dotenv). Active maintenance with recent commits and no known vulnerabilities.
Requires Python >=3.10. For Claude Desktop use, wikipedia-mcp command must be in PATH or full path specified in config.
License in practice
MIT license permits commercial and private use with minimal restrictions—suitable for most deployment scenarios.
Quickstart
pip install wikipedia-mcp
wikipedia-mcp --transport stdio
# In Claude Desktop config:
# {"mcpServers": {"wikipedia": {"command": "wikipedia-mcp"}}}Verify before relying
- Whether caching (--enable-cache) persists across server restarts and what storage backend it uses.
- Rate-limiting behavior when accessing Wikipedia without a personal access token.
- Performance characteristics for large article retrievals or high-volume queries.
Package facts
| License | MIT permissive |
| Python support | Supports the current Python release >=3.10 |
| Install friction | Low. Pure-Python wheel |
| Runtime dependencies | 4 packagesfastmcpwikipedia-apirequestspython-dotenv |
| Maintenance | Actively maintained 105 days since the last release |
| Last repo commit | |
| First released | |
| Downloads | 118,638 / month, #12,108 on PyPI 30-day window, as of 2026-08-14 |
| Known vulnerabilities | None known OSV.dev, checked 2026-08-14 |
| Classifiers | Development Status :: 4 - BetaIntended Audience :: DevelopersOperating System :: OS IndependentProgramming Language :: Python :: 3.10Programming Language :: Python :: 3.11Programming Language :: Python :: 3.12Topic :: Software Development :: Libraries :: Python Modules |
Evidence: wikipedia_mcp-2.0.1-py3-none-any.whl
Tags
Let your AI agent find packages like this
Example. Real query, live index.
You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.
wish › “wikipedia api for llms”
- wikipedia-mcpExposes Wikipedia search, article retrieval, and content extraction…
- wikipediaProvides simple Python access to Wikipedia article data through the…
- Wikipedia-APIWikipedia-API is a Python wrapper for Wikipedia's MediaWiki API that…
Give your agent the search over MCP, or paste the wish link into any chat.
More Python Modules packages
Converts domain names between Unicode and ASCII-compatible encoding (Punycode) according to IDNA 2008 and Unicode Technical Standard 46, with security validation and broader script coverage than the standard library.
Install it if you work with internationalized domain names, need to validate domains, or use HTTP clients that depend on it transitively.
Setuptools is a Python build backend and package management tool that handles building, distributing, and installing Python packages, including support for C/C++ extension modules.
PyYAML parses and emits YAML 1.1 data format, enabling serialization and deserialization of configuration files and Python objects to and from human-readable YAML text.
Pydantic validates Python data structures against type hints, coercing and checking input at runtime to ensure it matches a declared schema.
Provides reusable metadata objects for use with PEP-593 `typing.Annotated` to express common constraints like bounds, collection sizes, and predicates on types.
Install it if you use or build libraries that need to express type constraints in a standardized, inspectable way—or if you want to annotate your own types with…
Provides runtime tools to inspect and introspect Python type annotations, enabling programmatic examination of type hints at execution time.
See also duckduckgo-mcp-server · mcp-server-qdrant · office-word-mcp-server · tilt-mcp · django-mcp-server · cli-mcp-server · wikipedia · mcp-atlassian · Wikipedia-API · lexisnexisapi