$npx skillfedfor your agent

locust

Developer-friendly load testing framework

Worth itPyPI TestingReleased Aug 202614.1M downloads / moMITPure Python

Decision gist · record as of 2026-08-14

pure-Python wheel — locust-2.46.3-py3-none-any.whl
v2.46.3 · released 2026-08-01 · Python >=3.11 · 16 runtime deps: configargparse, flask-cors, flask-login, flask, gevent, geventhttpclient, msgpack, psutil

Yes. Locust is actively maintained, has no known vulnerabilities, installs with low friction, and is well-suited for teams that prefer writing tests in Python over GUI-based tools. The permissive MIT license removes legal friction. Install it if you need load testing with code-based test definition, distributed scaling, and real-time monitoring—especially for HTTP services or when you want to avoid proprietary testing platforms.AI-flagged interpretation of the facts on this page — verify before relying

Before you install

  • Requires Python 3.11 or later.
  • Low install friction with a pure-Python wheel distribution.
  • Actively maintained with a recent release (13 days ago) and strong community engagement (28071 GitHub stars).

License · maintenance · safety

MIT (permissive) — MIT license is permissive, allowing commercial and private use with minimal restrictions—you may use, modify, and distribute Locust freely as long as you include the license notice.

last release 2026-08-01 (13 days) · last repo commit 2026-08-10 · 28,071 stars

0 known vulnerabilities (OSV.dev, 2026-08-14) · 14,055,255 downloads/mo, #1,250 on PyPI

Verify before relying

pip install locust

from locust import HttpUser, task, between

class TestUser(HttpUser):
    wait_time = between(1, 2)
    
    @task
    def test_endpoint(self):
        self.client.get("/api/endpoint")
  • Whether gevent-based concurrency model meets specific throughput or latency requirements for your workload.
  • Performance characteristics when scaling to hundreds of thousands of users.
  • Compatibility with custom protocol clients beyond HTTP.
Same gist for agents: .md · .json

What it is and what it does

Locust is a developer-friendly load testing framework that lets you write performance tests in regular Python code rather than XML or domain-specific languages. Tests define user behavior using Python classes and decorators, with each simulated user running in its own lightweight greenlet (via gevent), enabling natural blocking-style code. The framework supports distributed testing across multiple machines to simulate concurrent users, and provides both a web-based UI for real-time monitoring and command-line execution for CI/CD integration.

You write test scenarios as Python code, import libraries freely, and leverage Locust's pluggable architecture to extend or adapt behavior. The framework can test HTTP services by default and is extensible to other protocols. Results—throughput, response times, errors—are viewable in real time and exportable for analysis. Its small, intentionally minimal codebase makes it easy to customize for specific use cases without being locked into a GUI or predefined patterns.

Use it for

  • Simulate concurrent HTTP traffic to measure web service response times and throughput under load before production deployment.
  • Run distributed load tests across multiple machines to stress-test APIs with concurrent users.
  • Automate performance regression testing in CI/CD pipelines by running headless Locust tests and exporting results.
  • Test non-HTTP protocols or custom systems by writing a client in Python and plugging it into Locust's user model.
  • Monitor real-time test progress via the web UI and adjust load parameters mid-test without stopping the scenario.

Worth the install?

AI-flagged interpretation of the facts on this page. Verify before relying on it.

Worth it

Yes.

Locust is actively maintained, has no known vulnerabilities, installs with low friction, and is well-suited for teams that prefer writing tests in Python over GUI-based tools. The permissive MIT license removes legal friction. Install it if you need load testing with code-based test definition, distributed scaling, and real-time monitoring—especially for HTTP services or when you want to avoid proprietary testing platforms.

Install

locust on PyPI

Before you install

Low install friction with a pure-Python wheel distribution. Actively maintained with a recent release (13 days ago) and strong community engagement (28071 GitHub stars). Supports current Python versions (3.11–3.15).

Requires Python 3.11 or later.

License in practice

MIT license is permissive, allowing commercial and private use with minimal restrictions—you may use, modify, and distribute Locust freely as long as you include the license notice.

Quickstart

pip install locust

from locust import HttpUser, task, between

class TestUser(HttpUser):
    wait_time = between(1, 2)
    
    @task
    def test_endpoint(self):
        self.client.get("/api/endpoint")

Verify before relying

  • Whether gevent-based concurrency model meets specific throughput or latency requirements for your workload.
  • Performance characteristics when scaling to hundreds of thousands of users.
  • Compatibility with custom protocol clients beyond HTTP.

Package facts

LicenseMIT permissive
Python supportSupports the current Python release >=3.11
Install frictionLow. Pure-Python wheel
Runtime dependencies
16 packages
configargparseflask-corsflask-loginflaskgeventgeventhttpclientmsgpackpsutilpytestpython-engineiopython-socketiopywin32pyzmqrequeststyping-extensionswerkzeug
MaintenanceActively maintained 13 days since the last release
Last repo commit
First released
Downloads14,055,255 / month, #1,250 on PyPI 30-day window, as of 2026-08-14
Known vulnerabilitiesNone known OSV.dev, checked 2026-08-14
Classifiers
Development Status :: 5 - Production/StableIntended Audience :: DevelopersIntended Audience :: System AdministratorsLicense :: OSI Approved :: MIT LicenseOperating System :: OS IndependentProgramming Language :: PythonProgramming Language :: Python :: 3Programming Language :: Python :: 3.11Programming Language :: Python :: 3.12Programming Language :: Python :: 3.13Programming Language :: Python :: 3.14Programming Language :: Python :: 3.15Topic :: Software Development :: TestingTopic :: Software Development :: Testing :: Traffic GenerationTopic :: System :: Distributed Computing

Evidence: locust-2.46.3-py3-none-any.whl

Tags

Capabilities
load testing frameworkperformance testing pythonhttp load testingdistributed load testingconcurrent user simulationstress testing toolweb service load test
Topics
load-testingperformance-testingdistributed-testing

Let your AI agent find packages like this

Example. Real query, live index.

You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.

wish › “concurrent user simulation”

  • locustLocust is a Python-based load testing framework that lets you write…
  • openseespylinuxOpenSeesPy Linux provides a Python interface to OpenSees, an…
  • FMPyFMPy simulates Functional Mock-up Units (FMUs) conforming to FMI 1.0,…

Give your agent the search over MCP, or paste the wish link into any chat.

More Testing packages

pluggy Worth it
PyPI · Libraries · released May 2025

Pluggy provides a plugin system that lets you define hook specifications and register implementations to be called in sequence, enabling extensible Python applications without tight coupling.

Install it if you're building an extensible application or framework.

MITpure Python · 3.9+aging
1.3Bdownloads / mo
pytest Worth it
PyPI · Libraries · released Jun 2026

pytest is a testing framework that lets you write test functions using plain assert statements and automatically discovers and runs them, with detailed failure reporting.

MITpure Python · 3.10+
1.1Bdownloads / mo
virtualenv Worth it
PyPI · Libraries · released Aug 2026

virtualenv creates isolated Python environments where packages can be installed independently without affecting the system Python or other projects.

MITpure Python · 3.9+
532.9Mdownloads / mo
coverage Worth it
PyPI · Testing · released Aug 2026

Coverage.py measures which lines of Python code are executed during test runs, reporting coverage percentages and identifying untested code paths.

Install it if you want to measure test completeness or enforce coverage thresholds in your project.

permissive licensepure Python · 3.10+
335.8Mdownloads / mo
pytest-asyncio Worth it
PyPI · Testing · released May 2026

pytest-asyncio is a pytest plugin that enables writing and running async test functions using the asyncio library, allowing developers to await code directly within test cases.

Install it if you write tests for any asyncio-based code.

Apache-2.0pure Python · 3.10+
275.9Mdownloads / mo
pytest-json-ctrf Worth it
PyPI · Testing · released Jul 2026

A pytest plugin that generates test reports in Common Test Report Format (CTRF) as JSON, compatible with pytest-xdist and pytest-playwright for distributed and browser-based testing.

Install it if you need CTRF-formatted test output for CI/CD integration or cross-tool reporting.

MITpure Python · 3.8+
273.0Mdownloads / mo

See also locust-cloud · locust-plugins · bzt · rfswarm-agent · apache-airflow-microsoft-fabric-plugin · azure-batch · azure-storage-queue · azure-cli-core · greenlet · agent-framework-ollama