fastcrud
FastCRUD is a Python package for FastAPI, offering robust async CRUD operations and flexible endpoint creation utilities.
Decision gist · record as of 2026-08-14
Yes. FastCRUD is actively maintained, has low install friction, carries no security vulnerabilities, and uses a permissive MIT license. It is well-suited for FastAPI projects that need to reduce CRUD boilerplate and want built-in support for pagination and joins. The main gotcha is the requirement for async SQLAlchemy and Python 3.10+; if your project uses synchronous SQLAlchemy or older Python, it won't fit. The bundled AI agent skill adds value for teams using modern coding assistants.AI-flagged interpretation of the facts on this page — verify before relying
Before you install
- Requires Python 3.10 or newer; requires async SQLAlchemy setup with AsyncSession.
- Non-native SQLAlchemy column types (e.g., from sqlalchemy-utils) may raise NotImplementedError unless a python_type attribute is added.
- Low friction installation with a pure Python wheel.
License · maintenance · safety
MIT (permissive) — MIT license (permissive) allows use in commercial and private projects with minimal restrictions. You must include a copy of the license and copyright notice.
last release 2026-06-21 (54 days) · last repo commit 2026-06-21 · 1,555 stars
0 known vulnerabilities (OSV.dev, 2026-08-14) · 133,664 downloads/mo, #11,500 on PyPI
Alternatives
Verify before relying
pip install fastcrud
from fastcrud import crud_router
from fastapi import FastAPI
app = FastAPI()
item_router = crud_router(
session=get_session,
model=Item,
create_schema=ItemCreateSchema,
update_schema=ItemUpdateSchema,
path="/items",
)
app.include_router(item_router)- Whether the bundled Library Skill integration with AI coding agents (Claude Code, Cursor, Copilot) is actively maintained and compatible with current agent versions.
- Performance characteristics and scalability limits for large datasets or complex join scenarios compared to raw SQLAlchemy.
- Whether the three-tier pagination default and limit=None behavior are well-documented enough to avoid common mistakes in production.
What it is and what it does
FastCRUD is a FastAPI extension that wraps SQLAlchemy 2.0 to provide async CRUD operations with automatic REST endpoint generation. It eliminates boilerplate by offering a crud_router that creates standard create, read, update, and delete endpoints from your SQLAlchemy models and Pydantic schemas, or by letting you use FastCRUD directly in custom endpoints for finer control.
The package handles common database patterns: dynamic filtering with operators like __gte and __ilike, automatic join condition detection for related models, offset and cursor-based pagination for different use cases, and soft deletes. It ships with a bundled Library Skill for AI coding agents that teaches when to use FastCRUD and when to drop to raw SQLAlchemy (for aggregates, CTEs, GROUP BY, or bulk writes). The main constraint is that it requires async SQLAlchemy setup and Python 3.10+.
Use it for
- Rapidly scaffold REST APIs for FastAPI applications by auto-generating CRUD endpoints from SQLAlchemy models without writing boilerplate route handlers.
- Build paginated list endpoints with cursor-based pagination for infinite-scroll interfaces or offset pagination for traditional pagination UI.
- Query related data with automatic join detection and dynamic filtering, sorting, and field selection in a single method call.
- Implement soft-delete patterns and custom filtering logic across multiple endpoints by defining it once in a FastCRUD instance.
- Integrate with AI coding agents (Claude Code, Cursor, Copilot) via the bundled Library Skill to generate correct async CRUD code with N+1 avoidance.
Worth the install?
AI-flagged interpretation of the facts on this page. Verify before relying on it.
Yes.
FastCRUD is actively maintained, has low install friction, carries no security vulnerabilities, and uses a permissive MIT license. It is well-suited for FastAPI projects that need to reduce CRUD boilerplate and want built-in support for pagination and joins. The main gotcha is the requirement for async SQLAlchemy and Python 3.10+; if your project uses synchronous SQLAlchemy or older Python, it won't fit. The bundled AI agent skill adds value for teams using modern coding assistants.
Install
fastcrud on PyPI
Before you install
Low friction installation with a pure Python wheel. Actively maintained with recent releases; last commit on 2026-06-21. Depends on fastapi, pydantic, sqlalchemy, and sqlalchemy-utils—all standard FastAPI ecosystem packages with no exotic system dependencies.
Requires Python 3.10 or newer; requires async SQLAlchemy setup with AsyncSession. Non-native SQLAlchemy column types (e.g., from sqlalchemy-utils) may raise NotImplementedError unless a python_type attribute is added.
License in practice
MIT license (permissive) allows use in commercial and private projects with minimal restrictions. You must include a copy of the license and copyright notice.
Quickstart
pip install fastcrud
from fastcrud import crud_router
from fastapi import FastAPI
app = FastAPI()
item_router = crud_router(
session=get_session,
model=Item,
create_schema=ItemCreateSchema,
update_schema=ItemUpdateSchema,
path="/items",
)
app.include_router(item_router)Verify before relying
- Whether the bundled Library Skill integration with AI coding agents (Claude Code, Cursor, Copilot) is actively maintained and compatible with current agent versions.
- Performance characteristics and scalability limits for large datasets or complex join scenarios compared to raw SQLAlchemy.
- Whether the three-tier pagination default and limit=None behavior are well-documented enough to avoid common mistakes in production.
Package facts
| License | MIT permissive |
| Python support | Supports the current Python release <4,>=3.10 |
| Install friction | Low. Pure-Python wheel |
| Runtime dependencies | 4 packagesfastapipydanticsqlalchemy-utilssqlalchemy |
| Maintenance | Actively maintained 54 days since the last release |
| Last repo commit | |
| First released | |
| Downloads | 133,664 / month, #11,500 on PyPI 30-day window, as of 2026-08-14 |
| Known vulnerabilities | None known OSV.dev, checked 2026-08-14 |
| Classifiers | Development Status :: 4 - BetaFramework :: FastAPIIntended Audience :: DevelopersLicense :: OSI Approved :: MIT LicenseOperating System :: OS IndependentProgramming Language :: Python :: 3Programming Language :: Python :: 3.10Programming Language :: Python :: 3.11Programming Language :: Python :: 3.12Programming Language :: Python :: 3.13Topic :: Software Development :: LibrariesTyping :: Typed |
Evidence: fastcrud-0.22.3-py3-none-any.whl
Tags
Let your AI agent find packages like this
Example. Real query, live index.
You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.
wish › “fastapi crud operations”
- fastcrudFastCRUD provides async CRUD operations and automatic endpoint…
- advanced-alchemyAdvanced Alchemy provides sync and async SQLAlchemy repositories with…
- fastapi-restfulProvides utilities and base classes to reduce boilerplate when…
Give your agent the search over MCP, or paste the wish link into any chat.
More Libraries packages
urllib3 is an HTTP client library that provides thread-safe connection pooling, SSL/TLS verification, multipart file uploads, request retries, compression support, and proxy handling for Python applications.
Requests is a Python HTTP library that simplifies sending HTTP/1.1 requests with automatic handling of headers, authentication, cookies, and response parsing.
Pluggy provides a plugin system that lets you define hook specifications and register implementations to be called in sequence, enabling extensible Python applications without tight coupling.
Install it if you're building an extensible application or framework.
Provides parsing, arithmetic, and recurrence rule computation for dates and times, with timezone support and iCalendar RFC compliance.
Install it if you need to parse flexible date strings, compute relative dates, handle timezones, or work with recurrence rules—it's the de facto choice for these tasks.
Six provides utility functions to write Python code that runs on both Python 2.7 and Python 3.3+, smoothing over language differences between the two versions.
pytest is a testing framework that lets you write test functions using plain assert statements and automatically discovers and runs them, with detailed failure reporting.
See also fastapi-filter · fastapi-pagination · sqlakeyset · ormar · fastapi-utils · casbin-async-sqlalchemy-adapter · fastapi-restful · FastAPI-SQLAlchemy · fastapi · fastapi-users-db-sqlalchemy