cvxpy
A domain-specific language for modeling convex optimization problems in Python.
Decision gist · record as of 2026-08-14
Yes. CVXPY is a mature, actively maintained package (latest release 53 days ago, 6299 GitHub stars) with permissive Apache-2.0 licensing, no known vulnerabilities, and broad solver support. Medium install friction is justified by the complexity of the underlying solvers. Install it if you need to model and solve convex or mixed-integer optimization problems in Python without writing solver-specific code.AI-flagged interpretation of the facts on this page — verify before relying
Before you install
- Requires Python >= 3.11.
- Solvers (osqp, clarabel, scs, highspy) must be installed as dependencies; additional solvers may require separate installation.
- Medium install friction due to 8 runtime dependencies including compiled solvers (osqp, clarabel, scs, highspy, qdldl) and numerical libraries (numpy, scipy, sparsediffpy).
License · maintenance · safety
Apache-2.0 (permissive) — Apache-2.0 permissive license allows commercial and private use with minimal restrictions; you may use, modify, and distribute CVXPY and derivative works freely provided you retain license and copyright notices.
last release 2026-06-22 (53 days) · last repo commit 2026-08-12 · 6,299 stars
0 known vulnerabilities (OSV.dev, 2026-08-14) · 5,130,168 downloads/mo, #2,162 on PyPI
Alternatives
Verify before relying
pip install cvxpy
import cvxpy as cp
import numpy
x = cp.Variable(20)
objective = cp.Minimize(cp.sum_squares(A @ x - b))
constraints = [0 <= x, x <= 1]
prob = cp.Problem(objective, constraints)
result = prob.solve()
print(x.value)- Performance characteristics and scalability limits for large-scale problems are not specified in the fact sheet.
- Solver selection strategy and how CVXPY chooses among available solvers (osqp, clarabel, scs, highspy) is not detailed.
- Whether all 8 runtime dependencies are mandatory or if some are optional for specific use cases.
What it is and what it does
CVXPY is a domain-specific language embedded in Python that lets you write convex optimization problems in mathematical notation rather than solver-specific standard form. You define variables, an objective function, and constraints using CVXPY's API, then call solve() to delegate to one of several open-source solvers (Clarabel, SCS, OSQP, HiGHS). It handles the translation and returns optimal values and dual variables.
The package supports a broad range of problem classes: convex optimization (the primary use case), mixed-integer convex problems, geometric programs, quasiconvex programs, and nonlinear programs. It relies on 8 runtime dependencies—numerical libraries (numpy, scipy, sparsediffpy) and solver backends (osqp, clarabel, scs, highspy, qdldl)—all of which install together. The project is actively maintained, has been in development since 2014, and is widely used in research and industry.
Use it for
- Solve least-squares problems with variable bounds, as shown in the documentation example.
- Formulate and solve portfolio optimization problems with convex constraints.
- Model resource allocation and scheduling problems as convex or mixed-integer programs.
- Prototype control and signal processing algorithms that rely on convex optimization.
- Solve geometric programming problems for engineering design and optimization.
- Develop machine learning models that incorporate convex loss functions and regularization.
Worth the install?
AI-flagged interpretation of the facts on this page. Verify before relying on it.
Yes.
CVXPY is a mature, actively maintained package (latest release 53 days ago, 6299 GitHub stars) with permissive Apache-2.0 licensing, no known vulnerabilities, and broad solver support. Medium install friction is justified by the complexity of the underlying solvers. Install it if you need to model and solve convex or mixed-integer optimization problems in Python without writing solver-specific code.
Install
cvxpy on PyPI
Before you install
Medium install friction due to 8 runtime dependencies including compiled solvers (osqp, clarabel, scs, highspy, qdldl) and numerical libraries (numpy, scipy, sparsediffpy). Pre-built wheels available for modern Python versions (3.11–3.14) across macOS, Linux, and Windows. Active maintenance with a recent release 53 days ago.
Requires Python >= 3.11. Solvers (osqp, clarabel, scs, highspy) must be installed as dependencies; additional solvers may require separate installation.
License in practice
Apache-2.0 permissive license allows commercial and private use with minimal restrictions; you may use, modify, and distribute CVXPY and derivative works freely provided you retain license and copyright notices.
Quickstart
pip install cvxpy
import cvxpy as cp
import numpy
x = cp.Variable(20)
objective = cp.Minimize(cp.sum_squares(A @ x - b))
constraints = [0 <= x, x <= 1]
prob = cp.Problem(objective, constraints)
result = prob.solve()
print(x.value)Verify before relying
- Performance characteristics and scalability limits for large-scale problems are not specified in the fact sheet.
- Solver selection strategy and how CVXPY chooses among available solvers (osqp, clarabel, scs, highspy) is not detailed.
- Whether all 8 runtime dependencies are mandatory or if some are optional for specific use cases.
Package facts
| License | Apache-2.0 permissive |
| Python support | Supports the current Python release >=3.11 |
| Install friction | Medium. Platform-specific wheel |
| Runtime dependencies | 8 packagesosqpclarabelscsnumpyscipyhighspyqdldlsparsediffpy |
| Maintenance | Actively maintained 53 days since the last release |
| Last repo commit | |
| First released | |
| Downloads | 5,130,168 / month, #2,162 on PyPI 30-day window, as of 2026-08-14 |
| Known vulnerabilities | None known OSV.dev, checked 2026-08-14 |
Evidence: cvxpy-1.9.2-cp311-cp311-macosx_10_9_universal2.whl; cvxpy-1.9.2-cp311-cp311-macosx_10_9_x86_64.whl; cvxpy-1.9.2-cp311-cp311-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl; cvxpy-1.9.2-cp311-cp311-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl; cvxpy-1.9.2-cp311-cp311-win_amd64.whl; cvxpy-1.9.2-cp312-cp312-macosx_10_13_universal2.whl; cvxpy-1.9.2-cp312-cp312-macosx_10_13_x86_64.whl; cvxpy-1.9.2-cp312-cp312-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl; cvxpy-1.9.2-cp312-cp312-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl; cvxpy-1.9.2-cp312-cp312-win_amd64.whl; cvxpy-1.9.2-cp313-cp313-macosx_10_13_universal2.whl; cvxpy-1.9.2-cp313-cp313-macosx_10_13_x86_64.whl; cvxpy-1.9.2-cp313-cp313-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl; cvxpy-1.9.2-cp313-cp313-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl; cvxpy-1.9.2-cp313-cp313-win_amd64.whl; cvxpy-1.9.2-cp314-cp314-macosx_10_15_universal2.whl; cvxpy-1.9.2-cp314-cp314-macosx_10_15_x86_64.whl; cvxpy-1.9.2-cp314-cp314-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl; cvxpy-1.9.2-cp314-cp314-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl; cvxpy-1.9.2-cp314-cp314t-macosx_10_15_universal2.whl
Tags
Let your AI agent find packages like this
Example. Real query, live index.
You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.
wish › “convex optimization modeling”
- cvxpyCVXPY is a Python modeling language for expressing and solving convex…
- scsscs is a Python interface to the Splitting Conic Solver, a numerical…
- cvxpy-basecvxpy-base provides compiled solver kernels for CVXPY, a Python…
Give your agent the search over MCP, or paste the wish link into any chat.
More Mathematics packages
NetworkX provides data structures and algorithms for creating, analyzing, and manipulating graphs and networks, supporting everything from simple undirected graphs to complex directed and weighted networks.
kiwisolver is a Python binding to a fast C++ implementation of the Cassowary constraint solver, enabling you to solve systems of linear constraints and inequalities.
Install it if you need to solve constraint systems; skip it if you only need simple linear algebra.
SymPy is a Python library for symbolic mathematics, performing algebraic manipulation, calculus, equation solving, and mathematical expression simplification without numerical approximation.
ContourPy calculates contours of 2D quadrilateral grids using C++11 algorithms wrapped in Python, offering serial and multithreaded implementations without requiring Matplotlib as a dependency.
PyTorch provides GPU-accelerated tensor computation and automatic differentiation for building and training deep neural networks in Python.
onnxruntime loads and executes Open Neural Network Exchange (ONNX) models with a focus on inference performance across CPUs and accelerators.
Install it if you have ONNX models to run in production or development.
See also cobra · cvxpy-base · pyomo · qpsolvers · ropwr · aimmspy · ecos · highspy · clarabel · scs