ansible-lint
Checks playbooks for practices and behavior that could potentially be improved
Decision gist · record as of 2026-08-14
Yes. ansible-lint is actively maintained, has no known vulnerabilities, and low install friction. The GPLv3 copyleft license is a consideration if you're building proprietary software, but it's the standard for Ansible tooling. Install it if you use Ansible and want automated quality checks on your playbooks.AI-flagged interpretation of the facts on this page — verify before relying
Before you install
- Requires Python 3.10 or later and ansible-core as a runtime dependency.
- Low install friction with a pure-Python wheel distribution.
- Active maintenance with a release 2 days old and 3896 repository stars.
License · maintenance · safety
GPL-3.0-or-later (copyleft) — Distributed under GPL-3.0-or-later due to copyleft runtime dependencies like ansible-core and yamllint. Own codebase is MIT-licensed, but the effective license for distribution is GPLv3.
last release 2026-08-12 (2 days) · last repo commit 2026-08-14 · 3,896 stars
0 known vulnerabilities (OSV.dev, 2026-08-14) · 5,340,142 downloads/mo, #2,116 on PyPI
Alternatives
Verify before relying
pip install ansible-lint
ansible-lint playbook.yml- Whether the package supports linting Ansible roles in addition to playbooks.
- What specific rule categories or checks are included in version 26.8.0.
- Whether custom rules or rule configuration is supported.
What it is and what it does
ansible-lint is a static analysis tool that scans Ansible playbooks and related automation code to identify practices that deviate from community standards or could cause issues in production. It runs as a command-line tool and integrates into CI/CD pipelines, including GitHub Actions. The package depends on ansible-core for Ansible compatibility, yamllint for YAML validation, and several supporting libraries for schema checking, YAML parsing, and file matching.
The tool is maintained as part of the official Ansible project and supports only the last two major versions of Ansible. It's designed for developers, system administrators, and infrastructure teams who want automated feedback on their Ansible code quality before deployment.
Use it for
- Run in CI/CD pipelines to automatically check playbooks on pull requests before merging.
- Enforce Ansible best practices across a team by catching common mistakes early.
- Validate playbook syntax and structure locally before committing to version control.
- Integrate into GitHub Actions workflows to gate deployments on code quality.
- Audit existing playbooks for compliance with organizational Ansible standards.
Worth the install?
AI-flagged interpretation of the facts on this page. Verify before relying on it.
Yes.
ansible-lint is actively maintained, has no known vulnerabilities, and low install friction. The GPLv3 copyleft license is a consideration if you're building proprietary software, but it's the standard for Ansible tooling. Install it if you use Ansible and want automated quality checks on your playbooks.
Install
ansible-lint on PyPI
Before you install
Low install friction with a pure-Python wheel distribution. Active maintenance with a release 2 days old and 3896 repository stars. Requires Python 3.10 or later.
Requires Python 3.10 or later and ansible-core as a runtime dependency.
License in practice
Distributed under GPL-3.0-or-later due to copyleft runtime dependencies like ansible-core and yamllint. Own codebase is MIT-licensed, but the effective license for distribution is GPLv3.
Quickstart
pip install ansible-lint
ansible-lint playbook.ymlVerify before relying
- Whether the package supports linting Ansible roles in addition to playbooks.
- What specific rule categories or checks are included in version 26.8.0.
- Whether custom rules or rule configuration is supported.
Package facts
| License | GPL-3.0-or-later copyleft |
| Python support | Supports the current Python release >=3.10 |
| Install friction | Low. Pure-Python wheel |
| Runtime dependencies | 17 packagesansible-compatansible-coreblackcfficryptographydistrofilelockjsonschemapackagingpathspecpyyamlreferencingruamel-yamlruamel-yaml-clibsubprocess-teewcmatchyamllint |
| Maintenance | Actively maintained 2 days since the last release |
| Last repo commit | |
| First released | |
| Downloads | 5,340,142 / month, #2,116 on PyPI 30-day window, as of 2026-08-14 |
| Known vulnerabilities | None known OSV.dev, checked 2026-08-14 |
| Classifiers | Development Status :: 5 - Production/StableEnvironment :: ConsoleIntended Audience :: DevelopersIntended Audience :: Information TechnologyIntended Audience :: System AdministratorsOperating System :: MacOSOperating System :: POSIXProgramming Language :: PythonProgramming Language :: Python :: 3Programming Language :: Python :: 3 :: OnlyProgramming Language :: Python :: 3.10Programming Language :: Python :: 3.11Programming Language :: Python :: 3.12Programming Language :: Python :: 3.13Programming Language :: Python :: 3.14Topic :: Software Development :: Quality AssuranceTopic :: Software Development :: TestingTopic :: System :: Systems AdministrationTopic :: Utilities |
Evidence: ansible_lint-26.8.0-py3-none-any.whl
Tags
Let your AI agent find packages like this
Example. Real query, live index.
You found this page by searching. An agent finds it by wishing: SkillFed indexes 14,416 PyPI packages by what they can do, searchable in plain language.
wish › “ansible playbook linter”
- ansible-lintansible-lint checks Ansible playbooks and roles for practices that…
- araARA Records Ansible records and reports on Ansible playbook execution…
- ansible-pygmentsProvides a Pygments lexer and style for syntax-highlighting Ansible…
Give your agent the search over MCP, or paste the wish link into any chat.
More Utilities packages
Converts domain names between Unicode and ASCII-compatible encoding (Punycode) according to IDNA 2008 and Unicode Technical Standard 46, with security validation and broader script coverage than the standard library.
Install it if you work with internationalized domain names, need to validate domains, or use HTTP clients that depend on it transitively.
Detects and normalizes text encoding from unknown or ambiguous sources, supporting all IANA character sets that Python's core library provides codecs for, with the ability to register custom codecs.
Setuptools is a Python build backend and package management tool that handles building, distributing, and installing Python packages, including support for C/C++ extension modules.
Pluggy provides a plugin system that lets you define hook specifications and register implementations to be called in sequence, enabling extensible Python applications without tight coupling.
Install it if you're building an extensible application or framework.
Pygments is a syntax highlighter that colorizes source code and text in over 500 languages and formats, outputting to HTML, LaTeX, RTF, SVG, images, or ANSI terminal sequences.
Install it if you need to display or transform source code.
Six provides utility functions to write Python code that runs on both Python 2.7 and Python 3.3+, smoothing over language differences between the two versions.
See also ansible-compat · ara · salt-lint · ansible-dev-tools · ansible-navigator · ansible-core · molecule · commitlint · ansible · ansible-runner